PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g04370.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SRS
Protein Properties Length: 478aa    MW: 50232.9 Da    PI: 8.9134
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g04370.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702219.47.9e-682544143154
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaesk 97 
                      gt++CqdCGnqakkdC+ +RCRtCCksrgfdC thvkstWvpaa+rrerq ++aa+++ a +s +++ +k++r   +++++++s+t++s+++++
  Vang01g04370.2 254 GGTTTCQDCGNQAKKDCTNRRCRTCCKSRGFDCPTHVKSTWVPAARRRERQLMTAATAAVAGSSGSTSGTKKPRLI-ASQTTTTSHTSTSNTTPP 347
                     5789*************************************************99999999999999999999986.88899999********** PP

          DUF702  98 keletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     ++++tss          lP +v+++avf+cvrv++v+dg++e+aYq++v+igGhvfkG+LydqG+e+
  Vang01g04370.2 348 RSFDTSSshqdagfkesLPGQVRAPAVFKCVRVTAVEDGQDEYAYQAVVKIGGHVFKGFLYDQGVEN 414
                     *****999********************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.3E-61256413IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016237.8E-27258300IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.8E-29365412IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
YINIYIYTHT HTHKHHIPIT YYKIYVSSSS IVLCFPHTIH PTFIKSTRKL YLVFYFIVFD  60
LRNQALSVVA TTRRLPSDSG AFADWAATGS SAAAAAAGGR AVPVDDLSLG FNAGPAAPAA  120
ATGPTSGMWS GANRSINYPE MGMFVVAPAS SFHHHHHQQQ PPHDPVMADS LNPATALGVG  180
VIPLLAATPC LESDNFLGNR PRGGGIQFWQ DQGPHQSHYM KKQQQQGLLD QSNTSSGNLV  240
QTSGGLTASG TSSGGTTTCQ DCGNQAKKDC TNRRCRTCCK SRGFDCPTHV KSTWVPAARR  300
RERQLMTAAT AAVAGSSGST SGTKKPRLIA SQTTTTSHTS TSNTTPPRSF DTSSSHQDAG  360
FKESLPGQVR APAVFKCVRV TAVEDGQDEY AYQAVVKIGG HVFKGFLYDQ GVENRDVYPN  420
LSELHLGGGN GGSGSGGSGG VGRNGVSSSP MMDPSDVYAG SGGGLLGGSS AYGNPMN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502940.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like, partial
SwissprotQ94CK93e-83LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A0S3RJT10.0A0A0S3RJT1_PHAAN; Uncharacterized protein
STRINGGLYMA02G44860.21e-177(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.42e-71Lateral root primordium (LRP) protein-related